PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID AA31G00506
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Aethionemeae; Aethionema
Family MYB
Protein Properties Length: 259aa    MW: 29431.5 Da    PI: 6.5093
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
AA31G00506genomeVEGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.89.3e-171461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g WT+eEde+lv ++++ G g+W++ + + g+ R++k+c++rw++yl
       AA31G00506 14 KGEWTAEEDEKLVAYINENGIGDWRLMPTRAGLQRCGKSCRLRWLNYL 61
                     799*******************************************97 PP

2Myb_DNA-binding55.91e-1767110146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      rg++T++E+e +++ + ++G++ W++Ia+ m+ +Rt++++k++w++
       AA31G00506  67 RGKFTPQEEESIIHFHSLHGNR-WAAIAKLMP-NRTDNDIKNYWNS 110
                      89********************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.485961IPR017930Myb domain
SuperFamilySSF466899.36E-3011108IPR009057Homeodomain-like
SMARTSM007177.3E-131363IPR001005SANT/Myb domain
PfamPF002492.5E-141461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.1E-231568IPR009057Homeodomain-like
CDDcd001671.37E-91661No hitNo description
PROSITE profilePS5129425.39862116IPR017930Myb domain
SMARTSM007172.2E-1666114IPR001005SANT/Myb domain
PfamPF002491.1E-1667110IPR001005SANT/Myb domain
CDDcd001679.17E-1169112No hitNo description
Gene3DG3DSA:1.10.10.605.0E-2669116IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 259 aa     Download sequence    Send to blast
MVRTTWLDVD GMKKGEWTAE EDEKLVAYIN ENGIGDWRLM PTRAGLQRCG KSCRLRWLNY  60
LRPGIKRGKF TPQEEESIIH FHSLHGNRWA AIAKLMPNRT DNDIKNYWNS RLKKRLAKSG  120
INPMTHKPVL TNVEPSSSIS TTGSSPCTPI SCSSKSNELL NKLATMISSK KEEIDKIKSV  180
IMCREVITNK DEKINFDVCM DWDELEQEME LEGCLIGTST STKTTSFDGS LGLVDELYGI  240
EQCGFYDTTT HESDHFLLL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A7e-26141167108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006390428.15e-89hypothetical protein EUTSA_v10018987mg
TrEMBLV4K9J55e-89V4K9J5_EUTSA; Uncharacterized protein
STRINGBra015911.1-P6e-85(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G74430.18e-77myb domain protein 95